Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for uihcv 61. uihcv Lv 1 13 pts. 9,122
  2. Avatar for pfirth 62. pfirth Lv 1 13 pts. 9,113
  3. Avatar for Deleted player 63. Deleted player pts. 9,104
  4. Avatar for Fog Darts 64. Fog Darts Lv 1 12 pts. 9,091
  5. Avatar for smholst 65. smholst Lv 1 11 pts. 9,088
  6. Avatar for Glen B 66. Glen B Lv 1 11 pts. 9,071
  7. Avatar for WBarme1234 67. WBarme1234 Lv 1 10 pts. 9,054
  8. Avatar for ViJay7019 68. ViJay7019 Lv 1 10 pts. 9,013
  9. Avatar for Soggy Doglog 69. Soggy Doglog Lv 1 9 pts. 8,970
  10. Avatar for SKSbell 70. SKSbell Lv 1 9 pts. 8,967

Comments