Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for ralan-nsk 81. ralan-nsk Lv 1 5 pts. 8,761
  2. Avatar for Merf 82. Merf Lv 1 5 pts. 8,740
  3. Avatar for Bushman 83. Bushman Lv 1 5 pts. 8,730
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 5 pts. 8,719
  5. Avatar for dizzywings 85. dizzywings Lv 1 5 pts. 8,652
  6. Avatar for Deleted player 86. Deleted player 4 pts. 8,645
  7. Avatar for frostschutz 87. frostschutz Lv 1 4 pts. 8,620
  8. Avatar for Alistair69 88. Alistair69 Lv 1 4 pts. 8,600
  9. Avatar for Deleted player 89. Deleted player pts. 8,593
  10. Avatar for fryguy 90. fryguy Lv 1 4 pts. 8,590

Comments