Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,557
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,536
  3. Avatar for Go Science 3. Go Science 58 pts. 9,534
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,490
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,486
  6. Avatar for Contenders 6. Contenders 22 pts. 9,455
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,440
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,412
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,269
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,268
  1. Avatar for kabubi
    1. kabubi Lv 1
    100 pts. 9,547
  2. Avatar for smilingone 2. smilingone Lv 1 81 pts. 9,536
  3. Avatar for LociOiling 3. LociOiling Lv 1 65 pts. 9,534
  4. Avatar for Hollinas 4. Hollinas Lv 1 52 pts. 9,534
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 41 pts. 9,524
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 32 pts. 9,524
  7. Avatar for Paulo Roque 7. Paulo Roque Lv 1 24 pts. 9,521
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 18 pts. 9,520
  9. Avatar for eromana 9. eromana Lv 1 14 pts. 9,486
  10. Avatar for Deleted player 10. Deleted player pts. 9,486

Comments