Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Void Crushers 100 pts. 9,557
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,536
  3. Avatar for Go Science 3. Go Science 58 pts. 9,534
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,490
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,486
  6. Avatar for Contenders 6. Contenders 22 pts. 9,455
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,440
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,412
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,269
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,268

  1. Avatar for benrh 111. benrh Lv 1 1 pt. 8,325
  2. Avatar for navn 112. navn Lv 1 1 pt. 8,325
  3. Avatar for vincethec 113. vincethec Lv 1 1 pt. 8,316
  4. Avatar for Rackera 114. Rackera Lv 1 1 pt. 8,305
  5. Avatar for Hollinas 115. Hollinas Lv 1 1 pt. 8,294
  6. Avatar for leehaggis 116. leehaggis Lv 1 1 pt. 8,236
  7. Avatar for marclacroix 117. marclacroix Lv 1 1 pt. 8,235
  8. Avatar for DScott 118. DScott Lv 1 1 pt. 8,232
  9. Avatar for WalkerP 119. WalkerP Lv 1 1 pt. 8,230
  10. Avatar for trentis1 120. trentis1 Lv 1 1 pt. 8,228

Comments