Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,557
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,536
  3. Avatar for Go Science 3. Go Science 58 pts. 9,534
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,490
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,486
  6. Avatar for Contenders 6. Contenders 22 pts. 9,455
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,440
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,412
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,269
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,268
  1. Avatar for MeZzo 161. MeZzo Lv 1 1 pt. 7,729
  2. Avatar for pielie 162. pielie Lv 1 1 pt. 7,708
  3. Avatar for 01010011111 163. 01010011111 Lv 1 1 pt. 7,544
  4. Avatar for Ebony Missick 164. Ebony Missick Lv 1 1 pt. 7,447
  5. Avatar for straydog_1212 165. straydog_1212 Lv 1 1 pt. 7,229
  6. Avatar for MyTI 166. MyTI Lv 1 1 pt. 7,140
  7. Avatar for jflat06 167. jflat06 Lv 1 1 pt. 3,210
  8. Avatar for RAH 168. RAH Lv 1 1 pt. 3,210
  9. Avatar for spvincent 169. spvincent Lv 1 1 pt. 3,210
  10. Avatar for eromana 170. eromana Lv 1 1 pt. 3,210

Comments