Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for xkcd 13. xkcd 1 pt. 8,671
  3. Avatar for Window Group 14. Window Group 1 pt. 8,188
  4. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663

  1. Avatar for rinze 111. rinze Lv 1 1 pt. 8,767
  2. Avatar for MadCat08 112. MadCat08 Lv 1 1 pt. 8,752
  3. Avatar for severin333 113. severin333 Lv 1 1 pt. 8,750
  4. Avatar for rsosborne 114. rsosborne Lv 1 1 pt. 8,743
  5. Avatar for boondog 115. boondog Lv 1 1 pt. 8,716
  6. Avatar for Deleted player 116. Deleted player pts. 8,714
  7. Avatar for Iron pet 117. Iron pet Lv 1 1 pt. 8,713
  8. Avatar for carinita 118. carinita Lv 1 1 pt. 8,703
  9. Avatar for trentis1 119. trentis1 Lv 1 1 pt. 8,703
  10. Avatar for cherry39 120. cherry39 Lv 1 1 pt. 8,680

Comments