Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for xkcd 13. xkcd 1 pt. 8,671
  3. Avatar for Window Group 14. Window Group 1 pt. 8,188
  4. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663

  1. Avatar for tweak64 121. tweak64 Lv 1 1 pt. 8,671
  2. Avatar for SouperGenious 122. SouperGenious Lv 1 1 pt. 8,653
  3. Avatar for martinf 123. martinf Lv 1 1 pt. 8,615
  4. Avatar for Hollinas 124. Hollinas Lv 1 1 pt. 8,595
  5. Avatar for DScott 125. DScott Lv 1 1 pt. 8,576
  6. Avatar for pandapharmd 126. pandapharmd Lv 1 1 pt. 8,575
  7. Avatar for rezaefar 127. rezaefar Lv 1 1 pt. 8,568
  8. Avatar for AeonFluff 128. AeonFluff Lv 1 1 pt. 8,547
  9. Avatar for Ref_Jo 129. Ref_Jo Lv 1 1 pt. 8,510
  10. Avatar for tomespen 130. tomespen Lv 1 1 pt. 8,495

Comments