Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,743
  3. Avatar for xkcd 13. xkcd 1 pt. 8,671
  4. Avatar for Window Group 14. Window Group 1 pt. 8,188
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 8,145
  6. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663
  1. Avatar for sammiibee16 131. sammiibee16 Lv 1 1 pt. 8,351
  2. Avatar for lamoille 132. lamoille Lv 1 1 pt. 8,282
  3. Avatar for NotJim99 133. NotJim99 Lv 1 1 pt. 8,255
  4. Avatar for dam_01 134. dam_01 Lv 1 1 pt. 8,209
  5. Avatar for DmitrySokolov 135. DmitrySokolov Lv 1 1 pt. 8,192
  6. Avatar for jflat06 136. jflat06 Lv 1 1 pt. 8,188
  7. Avatar for Crusher99333 137. Crusher99333 Lv 1 1 pt. 8,173
  8. Avatar for Larissa Santos 138. Larissa Santos Lv 1 1 pt. 8,145
  9. Avatar for mrmojo666 139. mrmojo666 Lv 1 1 pt. 8,136
  10. Avatar for Gianni Silverio 140. Gianni Silverio Lv 1 1 pt. 8,131

Comments