Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for xkcd 13. xkcd 1 pt. 8,671
  3. Avatar for Window Group 14. Window Group 1 pt. 8,188
  4. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663

  1. Avatar for crpainter 41. crpainter Lv 1 22 pts. 9,737
  2. Avatar for diamonddays 42. diamonddays Lv 1 22 pts. 9,735
  3. Avatar for Grom 43. Grom Lv 1 21 pts. 9,733
  4. Avatar for joremen 44. joremen Lv 1 20 pts. 9,729
  5. Avatar for Museka 45. Museka Lv 1 19 pts. 9,726
  6. Avatar for Blipperman 46. Blipperman Lv 1 18 pts. 9,719
  7. Avatar for ViJay7019 47. ViJay7019 Lv 1 17 pts. 9,703
  8. Avatar for stomjoh 48. stomjoh Lv 1 16 pts. 9,685
  9. Avatar for pfirth 49. pfirth Lv 1 16 pts. 9,674
  10. Avatar for cbwest 50. cbwest Lv 1 15 pts. 9,664

Comments