Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,743
  3. Avatar for xkcd 13. xkcd 1 pt. 8,671
  4. Avatar for Window Group 14. Window Group 1 pt. 8,188
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 8,145
  6. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663
  1. Avatar for fishercat 81. fishercat Lv 1 3 pts. 9,276
  2. Avatar for can1492 82. can1492 Lv 1 3 pts. 9,269
  3. Avatar for froggs554 83. froggs554 Lv 1 3 pts. 9,257
  4. Avatar for Merf 84. Merf Lv 1 3 pts. 9,243
  5. Avatar for lupussapien 85. lupussapien Lv 1 2 pts. 9,229
  6. Avatar for Fog Darts 86. Fog Darts Lv 1 2 pts. 9,218
  7. Avatar for benrh 87. benrh Lv 1 2 pts. 9,137
  8. Avatar for carsonfb 88. carsonfb Lv 1 2 pts. 9,071
  9. Avatar for firejuggler 89. firejuggler Lv 1 2 pts. 9,070
  10. Avatar for weitzen 90. weitzen Lv 1 2 pts. 9,058

Comments