Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,442
  3. Avatar for xkcd 13. xkcd 1 pt. 8,436
  4. Avatar for freefolder 14. freefolder 1 pt. 8,370
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820
  1. Avatar for Mr_Jolty 131. Mr_Jolty Lv 1 1 pt. 8,204
  2. Avatar for mike59 132. mike59 Lv 1 1 pt. 8,195
  3. Avatar for David M. 133. David M. Lv 1 1 pt. 8,188
  4. Avatar for jebbiek 134. jebbiek Lv 1 1 pt. 8,183
  5. Avatar for DScott 135. DScott Lv 1 1 pt. 8,183
  6. Avatar for trentis1 136. trentis1 Lv 1 1 pt. 8,182
  7. Avatar for navn 137. navn Lv 1 1 pt. 8,176
  8. Avatar for Mydogisa Toelicker 138. Mydogisa Toelicker Lv 1 1 pt. 8,175
  9. Avatar for can1492 139. can1492 Lv 1 1 pt. 8,173
  10. Avatar for coris 140. coris Lv 1 1 pt. 8,171

Comments