Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522
  1. Avatar for Mr_Jolty 131. Mr_Jolty Lv 1 1 pt. 8,204
  2. Avatar for mike59 132. mike59 Lv 1 1 pt. 8,195
  3. Avatar for David M. 133. David M. Lv 1 1 pt. 8,188
  4. Avatar for jebbiek 134. jebbiek Lv 1 1 pt. 8,183
  5. Avatar for DScott 135. DScott Lv 1 1 pt. 8,183
  6. Avatar for trentis1 136. trentis1 Lv 1 1 pt. 8,182
  7. Avatar for navn 137. navn Lv 1 1 pt. 8,176
  8. Avatar for Mydogisa Toelicker 138. Mydogisa Toelicker Lv 1 1 pt. 8,175
  9. Avatar for can1492 139. can1492 Lv 1 1 pt. 8,173
  10. Avatar for coris 140. coris Lv 1 1 pt. 8,171

Comments