Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 8,470
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,442
  3. Avatar for xkcd 13. xkcd 1 pt. 8,436
  4. Avatar for freefolder 14. freefolder 1 pt. 8,370
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,283
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,204
  7. Avatar for D001x Med Chem MOOC 17. D001x Med Chem MOOC 1 pt. 8,146
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,820
  1. Avatar for dahast.de 181. dahast.de Lv 1 1 pt. 7,415
  2. Avatar for D001x_JenBiggs 182. D001x_JenBiggs Lv 1 1 pt. 6,216
  3. Avatar for Takashi_Yoshida 183. Takashi_Yoshida Lv 1 1 pt. 5,842
  4. Avatar for Hollinas 184. Hollinas Lv 1 1 pt. 4,822
  5. Avatar for spvincent 185. spvincent Lv 1 1 pt. 4,822
  6. Avatar for potatopotatopotato 186. potatopotatopotato Lv 1 1 pt. 4,822

Comments