Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for harvardman 101. harvardman Lv 1 1 pt. 8,717
  2. Avatar for pandapharmd 102. pandapharmd Lv 1 1 pt. 8,715
  3. Avatar for spritz1992 103. spritz1992 Lv 1 1 pt. 8,696
  4. Avatar for Arne Heessels 104. Arne Heessels Lv 1 1 pt. 8,693
  5. Avatar for rinze 105. rinze Lv 1 1 pt. 8,689
  6. Avatar for JUMELLE54 106. JUMELLE54 Lv 1 1 pt. 8,678
  7. Avatar for dbuske 107. dbuske Lv 1 1 pt. 8,671
  8. Avatar for kamilko 108. kamilko Lv 1 1 pt. 8,668
  9. Avatar for altejoh 109. altejoh Lv 1 1 pt. 8,667
  10. Avatar for xplocast1 110. xplocast1 Lv 1 1 pt. 8,633

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).