Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Crossed Sticks 111. Crossed Sticks Lv 1 1 pt. 8,623
  2. Avatar for Alistair69 112. Alistair69 Lv 1 1 pt. 8,622
  3. Avatar for Superphosphate 113. Superphosphate Lv 1 1 pt. 8,622
  4. Avatar for Kiwegapa 114. Kiwegapa Lv 1 1 pt. 8,621
  5. Avatar for jermainiac 115. jermainiac Lv 1 1 pt. 8,620
  6. Avatar for can1492 116. can1492 Lv 1 1 pt. 8,610
  7. Avatar for trentis1 117. trentis1 Lv 1 1 pt. 8,598
  8. Avatar for Ref_Jo 118. Ref_Jo Lv 1 1 pt. 8,578
  9. Avatar for rsosborne 119. rsosborne Lv 1 1 pt. 8,570
  10. Avatar for versat82 120. versat82 Lv 1 1 pt. 8,523

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).