Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for classyjakey 121. classyjakey Lv 1 1 pt. 8,508
  2. Avatar for mike59 122. mike59 Lv 1 1 pt. 8,508
  3. Avatar for FishKAA 123. FishKAA Lv 1 1 pt. 8,504
  4. Avatar for jbmkfm125 124. jbmkfm125 Lv 1 1 pt. 8,471
  5. Avatar for DScott 125. DScott Lv 1 1 pt. 8,456
  6. Avatar for muhammed_kalayi 126. muhammed_kalayi Lv 1 1 pt. 8,449
  7. Avatar for jebbiek 127. jebbiek Lv 1 1 pt. 8,444
  8. Avatar for DipsyDoodle2016 128. DipsyDoodle2016 Lv 1 1 pt. 8,431
  9. Avatar for TastyMunchies 129. TastyMunchies Lv 1 1 pt. 8,417
  10. Avatar for fishercat 130. fishercat Lv 1 1 pt. 8,388

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).