Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for alrianne 131. alrianne Lv 1 1 pt. 8,384
  2. Avatar for fluttercute 132. fluttercute Lv 1 1 pt. 8,382
  3. Avatar for Ishigh 133. Ishigh Lv 1 1 pt. 8,375
  4. Avatar for saksoft2 134. saksoft2 Lv 1 1 pt. 8,321
  5. Avatar for Hollinas 135. Hollinas Lv 1 1 pt. 8,302
  6. Avatar for Shiny Green 136. Shiny Green Lv 1 1 pt. 8,272
  7. Avatar for martinf 137. martinf Lv 1 1 pt. 8,257
  8. Avatar for hansvandenhof 138. hansvandenhof Lv 1 1 pt. 8,251
  9. Avatar for Dagal 139. Dagal Lv 1 1 pt. 8,235
  10. Avatar for Deleted player 140. Deleted player 1 pt. 8,205

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).