Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for aspadistra 151. aspadistra Lv 1 1 pt. 7,878
  2. Avatar for Scopper 152. Scopper Lv 1 1 pt. 7,821
  3. Avatar for emdee314 153. emdee314 Lv 1 1 pt. 7,809
  4. Avatar for Giantbluefish 154. Giantbluefish Lv 1 1 pt. 7,805
  5. Avatar for przemek112233 155. przemek112233 Lv 1 1 pt. 7,785
  6. Avatar for jinhd6 156. jinhd6 Lv 1 1 pt. 7,785
  7. Avatar for sammiibee16 157. sammiibee16 Lv 1 1 pt. 7,783
  8. Avatar for binczews 158. binczews Lv 1 1 pt. 7,672
  9. Avatar for onanugao 159. onanugao Lv 1 1 pt. 7,616
  10. Avatar for gaving1 160. gaving1 Lv 1 1 pt. 7,564

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).