Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 73 pts. 9,246
  2. Avatar for nicobul 12. nicobul Lv 1 71 pts. 9,241
  3. Avatar for tokens 13. tokens Lv 1 69 pts. 9,233
  4. Avatar for Grom 14. Grom Lv 1 66 pts. 9,233
  5. Avatar for mimi 15. mimi Lv 1 64 pts. 9,225
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 62 pts. 9,220
  7. Avatar for Galaxie 17. Galaxie Lv 1 60 pts. 9,213
  8. Avatar for frood66 18. frood66 Lv 1 58 pts. 9,213
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 56 pts. 9,210
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 54 pts. 9,205

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).