Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  4. Avatar for Deleted group 16. Deleted group pts. 7,616

  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 73 pts. 9,246
  2. Avatar for nicobul 12. nicobul Lv 1 71 pts. 9,241
  3. Avatar for tokens 13. tokens Lv 1 69 pts. 9,233
  4. Avatar for Grom 14. Grom Lv 1 66 pts. 9,233
  5. Avatar for mimi 15. mimi Lv 1 64 pts. 9,225
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 62 pts. 9,220
  7. Avatar for Galaxie 17. Galaxie Lv 1 60 pts. 9,213
  8. Avatar for frood66 18. frood66 Lv 1 58 pts. 9,213
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 56 pts. 9,210
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 54 pts. 9,205

Comments


actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).