Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for lupussapien 21. lupussapien Lv 1 52 pts. 9,197
  2. Avatar for bertro 22. bertro Lv 1 50 pts. 9,176
  3. Avatar for smilingone 23. smilingone Lv 1 49 pts. 9,174
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 47 pts. 9,171
  5. Avatar for Keresto 25. Keresto Lv 1 45 pts. 9,165
  6. Avatar for johnmitch 26. johnmitch Lv 1 44 pts. 9,164
  7. Avatar for reefyrob 27. reefyrob Lv 1 42 pts. 9,161
  8. Avatar for Vinara 28. Vinara Lv 1 41 pts. 9,158
  9. Avatar for Blipperman 29. Blipperman Lv 1 39 pts. 9,155
  10. Avatar for randomlil 30. randomlil Lv 1 38 pts. 9,152

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).