Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for jobo0502 31. jobo0502 Lv 1 36 pts. 9,152
  2. Avatar for georg137 32. georg137 Lv 1 35 pts. 9,148
  3. Avatar for caglar 33. caglar Lv 1 34 pts. 9,141
  4. Avatar for O Seki To 34. O Seki To Lv 1 33 pts. 9,134
  5. Avatar for anthion 35. anthion Lv 1 31 pts. 9,134
  6. Avatar for katling 36. katling Lv 1 30 pts. 9,133
  7. Avatar for kabubi 37. kabubi Lv 1 29 pts. 9,131
  8. Avatar for dssb 38. dssb Lv 1 28 pts. 9,126
  9. Avatar for Norrjane 39. Norrjane Lv 1 27 pts. 9,124
  10. Avatar for Museka 40. Museka Lv 1 26 pts. 9,121

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).