Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Bushman 41. Bushman Lv 1 25 pts. 9,121
  2. Avatar for pvc78 42. pvc78 Lv 1 24 pts. 9,116
  3. Avatar for toshiue 43. toshiue Lv 1 23 pts. 9,114
  4. Avatar for joremen 44. joremen Lv 1 22 pts. 9,111
  5. Avatar for weitzen 45. weitzen Lv 1 21 pts. 9,104
  6. Avatar for carsonfb 46. carsonfb Lv 1 20 pts. 9,102
  7. Avatar for dcrwheeler 47. dcrwheeler Lv 1 19 pts. 9,090
  8. Avatar for Deleted player 48. Deleted player pts. 9,083
  9. Avatar for phi16 49. phi16 Lv 1 18 pts. 9,073
  10. Avatar for johngran 50. johngran Lv 1 17 pts. 9,063

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).