Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 16 pts. 9,054
  2. Avatar for Glen B 52. Glen B Lv 1 16 pts. 9,051
  3. Avatar for Merf 53. Merf Lv 1 15 pts. 9,042
  4. Avatar for smholst 54. smholst Lv 1 14 pts. 9,035
  5. Avatar for SaraL 55. SaraL Lv 1 14 pts. 9,025
  6. Avatar for guineapig 56. guineapig Lv 1 13 pts. 9,021
  7. Avatar for Deleted player 57. Deleted player pts. 9,018
  8. Avatar for isaksson 58. isaksson Lv 1 12 pts. 9,010
  9. Avatar for alwen 59. alwen Lv 1 11 pts. 9,006
  10. Avatar for MicElephant 60. MicElephant Lv 1 11 pts. 9,001

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).