Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for cbwest 61. cbwest Lv 1 10 pts. 8,988
  2. Avatar for tomespen 62. tomespen Lv 1 10 pts. 8,982
  3. Avatar for drjr 63. drjr Lv 1 9 pts. 8,974
  4. Avatar for deLaCeiba 64. deLaCeiba Lv 1 9 pts. 8,971
  5. Avatar for pfirth 65. pfirth Lv 1 9 pts. 8,964
  6. Avatar for mitarcher 66. mitarcher Lv 1 8 pts. 8,960
  7. Avatar for SKSbell 67. SKSbell Lv 1 8 pts. 8,957
  8. Avatar for tarimo 68. tarimo Lv 1 7 pts. 8,954
  9. Avatar for NinjaGreg 69. NinjaGreg Lv 1 7 pts. 8,948
  10. Avatar for manu8170 70. manu8170 Lv 1 7 pts. 8,935

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).