Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for firejuggler 81. firejuggler Lv 1 4 pts. 8,877
  2. Avatar for froggs554 82. froggs554 Lv 1 4 pts. 8,872
  3. Avatar for rabamino12358 83. rabamino12358 Lv 1 3 pts. 8,868
  4. Avatar for navn 84. navn Lv 1 3 pts. 8,852
  5. Avatar for leehaggis 85. leehaggis Lv 1 3 pts. 8,847
  6. Avatar for Anfinsen_slept_here 86. Anfinsen_slept_here Lv 1 3 pts. 8,834
  7. Avatar for cnhrcolemam 87. cnhrcolemam Lv 1 3 pts. 8,819
  8. Avatar for Flagg65a 88. Flagg65a Lv 1 3 pts. 8,816
  9. Avatar for joanieg 89. joanieg Lv 1 2 pts. 8,805
  10. Avatar for cobaltteal 90. cobaltteal Lv 1 2 pts. 8,803

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).