Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,317
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,304
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,299
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,284
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,276
  6. Avatar for Contenders 6. Contenders 14 pts. 9,272
  7. Avatar for Russian team 7. Russian team 8 pts. 9,233
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,210
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,134
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,121
  1. Avatar for Iron pet 91. Iron pet Lv 1 2 pts. 8,800
  2. Avatar for stomjoh 92. stomjoh Lv 1 2 pts. 8,799
  3. Avatar for senor pit 93. senor pit Lv 1 2 pts. 8,794
  4. Avatar for benrh 94. benrh Lv 1 2 pts. 8,781
  5. Avatar for ViJay7019 95. ViJay7019 Lv 1 2 pts. 8,778
  6. Avatar for Bobnine 96. Bobnine Lv 1 2 pts. 8,771
  7. Avatar for uihcv 97. uihcv Lv 1 2 pts. 8,752
  8. Avatar for Mr_Jolty 98. Mr_Jolty Lv 1 2 pts. 8,732
  9. Avatar for alcor29 99. alcor29 Lv 1 1 pt. 8,725
  10. Avatar for Simek 100. Simek Lv 1 1 pt. 8,722

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).