Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,317
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,304
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,299
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,284
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,276
  6. Avatar for Contenders 6. Contenders 14 pts. 9,272
  7. Avatar for Russian team 7. Russian team 8 pts. 9,233
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,210
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,134
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,121
  1. Avatar for Jim Fraser 71. Jim Fraser Lv 1 6 pts. 8,929
  2. Avatar for MadCat08 72. MadCat08 Lv 1 6 pts. 8,927
  3. Avatar for Imeturoran 73. Imeturoran Lv 1 6 pts. 8,920
  4. Avatar for fpc 74. fpc Lv 1 6 pts. 8,915
  5. Avatar for Deleted player 75. Deleted player pts. 8,914
  6. Avatar for ManVsYard 76. ManVsYard Lv 1 5 pts. 8,903
  7. Avatar for ralan-nsk 77. ralan-nsk Lv 1 5 pts. 8,895
  8. Avatar for diamonddays 78. diamonddays Lv 1 4 pts. 8,892
  9. Avatar for bcre8tvv 79. bcre8tvv Lv 1 4 pts. 8,886
  10. Avatar for Datstandin 80. Datstandin Lv 1 4 pts. 8,879

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).