Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 3 pts. 8,751
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 8,741
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,728
  4. Avatar for Deleted group 14. Deleted group pts. 8,712
  5. Avatar for :) 15. :) 1 pt. 8,597
  6. Avatar for xkcd 16. xkcd 1 pt. 8,583
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,544
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,415
  9. Avatar for Piratenpartei Deutschland 19. Piratenpartei Deutschland 1 pt. 8,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,860
  1. Avatar for frood66 91. frood66 Lv 1 2 pts. 8,679
  2. Avatar for Hollinas 92. Hollinas Lv 1 2 pts. 8,678
  3. Avatar for jebbiek 93. jebbiek Lv 1 2 pts. 8,672
  4. Avatar for cobaltteal 94. cobaltteal Lv 1 2 pts. 8,667
  5. Avatar for trentis1 95. trentis1 Lv 1 2 pts. 8,667
  6. Avatar for senor pit 96. senor pit Lv 1 2 pts. 8,660
  7. Avatar for harvardman 97. harvardman Lv 1 2 pts. 8,654
  8. Avatar for uihcv 98. uihcv Lv 1 1 pt. 8,647
  9. Avatar for katling 99. katling Lv 1 1 pt. 8,645
  10. Avatar for SKSbell 100. SKSbell Lv 1 1 pt. 8,644

Comments