Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 3 pts. 8,751
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 8,741
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,728
  4. Avatar for Deleted group 14. Deleted group pts. 8,712
  5. Avatar for :) 15. :) 1 pt. 8,597
  6. Avatar for xkcd 16. xkcd 1 pt. 8,583
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,544
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,415
  9. Avatar for Piratenpartei Deutschland 19. Piratenpartei Deutschland 1 pt. 8,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,860
  1. Avatar for justkae 151. justkae Lv 1 1 pt. 8,284
  2. Avatar for claire_kermit 152. claire_kermit Lv 1 1 pt. 8,272
  3. Avatar for racingsnailrider 153. racingsnailrider Lv 1 1 pt. 7,884
  4. Avatar for aspadistra 154. aspadistra Lv 1 1 pt. 7,860
  5. Avatar for 01010011111 155. 01010011111 Lv 1 1 pt. 7,832
  6. Avatar for Jonathan Shilen 156. Jonathan Shilen Lv 1 1 pt. 4,532
  7. Avatar for blue ears 157. blue ears Lv 1 1 pt. 4,532
  8. Avatar for DNALVR 158. DNALVR Lv 1 1 pt. 4,532
  9. Avatar for leakey0216 159. leakey0216 Lv 1 1 pt. 4,532
  10. Avatar for alcor29 160. alcor29 Lv 1 1 pt. 4,532

Comments