Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 8,741
  2. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,728
  3. Avatar for Deleted group 14. Deleted group pts. 8,712
  4. Avatar for :) 15. :) 1 pt. 8,597
  5. Avatar for xkcd 16. xkcd 1 pt. 8,583
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,544
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,415
  8. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,860

  1. Avatar for eusair 31. eusair Lv 1 36 pts. 8,841
  2. Avatar for Timo van der Laan 32. Timo van der Laan Lv 1 35 pts. 8,841
  3. Avatar for NinjaGreg 33. NinjaGreg Lv 1 33 pts. 8,838
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 32 pts. 8,835
  5. Avatar for isaksson 35. isaksson Lv 1 31 pts. 8,829
  6. Avatar for froggs554 36. froggs554 Lv 1 30 pts. 8,826
  7. Avatar for fpc 37. fpc Lv 1 28 pts. 8,823
  8. Avatar for randomlil 38. randomlil Lv 1 27 pts. 8,820
  9. Avatar for kabubi 39. kabubi Lv 1 26 pts. 8,814
  10. Avatar for Museka 40. Museka Lv 1 25 pts. 8,814

Comments