Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,933
  2. Avatar for Go Science 2. Go Science 77 pts. 8,929
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,927
  4. Avatar for Contenders 4. Contenders 43 pts. 8,927
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,913
  6. Avatar for HMT heritage 6. HMT heritage 22 pts. 8,890
  7. Avatar for Russian team 7. Russian team 15 pts. 8,887
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 8,886
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,841
  10. Avatar for freefolder 10. freefolder 5 pts. 8,783

  1. Avatar for caglar 11. caglar Lv 1 73 pts. 8,905
  2. Avatar for pauldunn 12. pauldunn Lv 1 71 pts. 8,899
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 68 pts. 8,898
  4. Avatar for Aubade01 14. Aubade01 Lv 1 66 pts. 8,892
  5. Avatar for O Seki To 15. O Seki To Lv 1 64 pts. 8,890
  6. Avatar for drjr 16. drjr Lv 1 62 pts. 8,888
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 60 pts. 8,887
  8. Avatar for Grom 18. Grom Lv 1 58 pts. 8,887
  9. Avatar for smholst 19. smholst Lv 1 56 pts. 8,886
  10. Avatar for actiasluna 20. actiasluna Lv 1 54 pts. 8,874

Comments