Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,933
  2. Avatar for Go Science 2. Go Science 77 pts. 8,929
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,927
  4. Avatar for Contenders 4. Contenders 43 pts. 8,927
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,913
  6. Avatar for HMT heritage 6. HMT heritage 22 pts. 8,890
  7. Avatar for Russian team 7. Russian team 15 pts. 8,887
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 8,886
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,841
  10. Avatar for freefolder 10. freefolder 5 pts. 8,783

  1. Avatar for Alistair69 51. Alistair69 Lv 1 16 pts. 8,774
  2. Avatar for dssb 52. dssb Lv 1 15 pts. 8,772
  3. Avatar for Glen B 53. Glen B Lv 1 15 pts. 8,769
  4. Avatar for ppp6 54. ppp6 Lv 1 14 pts. 8,766
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 13 pts. 8,765
  6. Avatar for johngran 56. johngran Lv 1 13 pts. 8,763
  7. Avatar for toshiue 57. toshiue Lv 1 12 pts. 8,762
  8. Avatar for tomespen 58. tomespen Lv 1 12 pts. 8,761
  9. Avatar for Flagg65a 59. Flagg65a Lv 1 11 pts. 8,756
  10. Avatar for WBarme1234 60. WBarme1234 Lv 1 11 pts. 8,751

Comments