Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 8,933
  2. Avatar for Go Science 2. Go Science 77 pts. 8,929
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,927
  4. Avatar for Contenders 4. Contenders 43 pts. 8,927
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 8,913
  6. Avatar for HMT heritage 6. HMT heritage 22 pts. 8,890
  7. Avatar for Russian team 7. Russian team 15 pts. 8,887
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 8,886
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,841
  10. Avatar for freefolder 10. freefolder 5 pts. 8,783

  1. Avatar for spritz1992 81. spritz1992 Lv 1 4 pts. 8,699
  2. Avatar for Deleted player 82. Deleted player pts. 8,696
  3. Avatar for mitarcher 83. mitarcher Lv 1 3 pts. 8,695
  4. Avatar for pandapharmd 84. pandapharmd Lv 1 3 pts. 8,693
  5. Avatar for alwen 85. alwen Lv 1 3 pts. 8,692
  6. Avatar for Merf 86. Merf Lv 1 3 pts. 8,689
  7. Avatar for boondog 87. boondog Lv 1 3 pts. 8,686
  8. Avatar for lupussapien 88. lupussapien Lv 1 2 pts. 8,683
  9. Avatar for dizzywings 89. dizzywings Lv 1 2 pts. 8,682
  10. Avatar for jermainiac 90. jermainiac Lv 1 2 pts. 8,680

Comments