Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,518
  2. Avatar for reefyrob 2. reefyrob Lv 1 84 pts. 9,518
  3. Avatar for smilingone 3. smilingone Lv 1 70 pts. 9,515
  4. Avatar for Galaxie 4. Galaxie Lv 1 58 pts. 9,510
  5. Avatar for lamoille 5. lamoille Lv 1 48 pts. 9,504
  6. Avatar for bertro 6. bertro Lv 1 39 pts. 9,501
  7. Avatar for phi16 7. phi16 Lv 1 32 pts. 9,499
  8. Avatar for ManVsYard 8. ManVsYard Lv 1 26 pts. 9,496
  9. Avatar for actiasluna 9. actiasluna Lv 1 20 pts. 9,494
  10. Avatar for Blipperman 10. Blipperman Lv 1 16 pts. 9,494

Comments