Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,518
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,511
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,496
  4. Avatar for Go Science 4. Go Science 33 pts. 9,485
  5. Avatar for Contenders 5. Contenders 22 pts. 9,330
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,190
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,157
  9. Avatar for freefolder 9. freefolder 3 pts. 9,151
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,986
  1. Avatar for eusair
    1. eusair Lv 1
    100 pts. 9,521
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 9,511
  3. Avatar for markm457 3. markm457 Lv 1 94 pts. 9,509
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 91 pts. 9,507
  5. Avatar for tokens 5. tokens Lv 1 88 pts. 9,502
  6. Avatar for MurloW 6. MurloW Lv 1 85 pts. 9,496
  7. Avatar for anthion 7. anthion Lv 1 82 pts. 9,494
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 79 pts. 9,483
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 77 pts. 9,482
  10. Avatar for Susume 10. Susume Lv 1 74 pts. 9,480

Comments