Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937

  1. Avatar for eusair
    1. eusair Lv 1
    100 pts. 9,521
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 9,511
  3. Avatar for markm457 3. markm457 Lv 1 94 pts. 9,509
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 91 pts. 9,507
  5. Avatar for tokens 5. tokens Lv 1 88 pts. 9,502
  6. Avatar for MurloW 6. MurloW Lv 1 85 pts. 9,496
  7. Avatar for anthion 7. anthion Lv 1 82 pts. 9,494
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 79 pts. 9,483
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 77 pts. 9,482
  10. Avatar for Susume 10. Susume Lv 1 74 pts. 9,480

Comments