Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for bcre8tvv 91. bcre8tvv Lv 1 2 pts. 8,716
  2. Avatar for cbwest 92. cbwest Lv 1 2 pts. 8,712
  3. Avatar for toshiue 93. toshiue Lv 1 1 pt. 8,707
  4. Avatar for Reldas 94. Reldas Lv 1 1 pt. 8,699
  5. Avatar for diamonddays 95. diamonddays Lv 1 1 pt. 8,628
  6. Avatar for boondog 96. boondog Lv 1 1 pt. 8,625
  7. Avatar for ViJay7019 97. ViJay7019 Lv 1 1 pt. 8,613
  8. Avatar for Savas 98. Savas Lv 1 1 pt. 8,591
  9. Avatar for jamiexq 99. jamiexq Lv 1 1 pt. 8,579
  10. Avatar for Alistair69 100. Alistair69 Lv 1 1 pt. 8,566

Comments