Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for momadoc 111. momadoc Lv 1 1 pt. 8,338
  2. Avatar for dbuske 112. dbuske Lv 1 1 pt. 8,338
  3. Avatar for senor pit 113. senor pit Lv 1 1 pt. 8,319
  4. Avatar for can1492 114. can1492 Lv 1 1 pt. 8,313
  5. Avatar for Roflez 115. Roflez Lv 1 1 pt. 8,313
  6. Avatar for YGK 116. YGK Lv 1 1 pt. 8,241
  7. Avatar for MadCat08 117. MadCat08 Lv 1 1 pt. 8,237
  8. Avatar for Arne Heessels 118. Arne Heessels Lv 1 1 pt. 8,232
  9. Avatar for rsosborne 119. rsosborne Lv 1 1 pt. 8,213
  10. Avatar for NotJim99 120. NotJim99 Lv 1 1 pt. 8,210

Comments