Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937

  1. Avatar for Soggy Doglog 121. Soggy Doglog Lv 1 1 pt. 8,145
  2. Avatar for Festering Wounds 122. Festering Wounds Lv 1 1 pt. 8,127
  3. Avatar for carsonfb 123. carsonfb Lv 1 1 pt. 8,092
  4. Avatar for newuserperson 124. newuserperson Lv 1 1 pt. 8,046
  5. Avatar for trentis1 125. trentis1 Lv 1 1 pt. 8,045
  6. Avatar for tomespen 126. tomespen Lv 1 1 pt. 7,999
  7. Avatar for rinze 127. rinze Lv 1 1 pt. 7,960
  8. Avatar for Chris67 128. Chris67 Lv 1 1 pt. 7,908
  9. Avatar for maman 129. maman Lv 1 1 pt. 7,815
  10. Avatar for jybourque 130. jybourque Lv 1 1 pt. 7,629

Comments