Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 22 pts. 9,157
  2. Avatar for Imeturoran 42. Imeturoran Lv 1 21 pts. 9,151
  3. Avatar for drjr 43. drjr Lv 1 20 pts. 9,139
  4. Avatar for andrewtmaxwell 44. andrewtmaxwell Lv 1 19 pts. 9,136
  5. Avatar for Skippysk8s 45. Skippysk8s Lv 1 19 pts. 9,135
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 18 pts. 9,129
  7. Avatar for Bruno Kestemont 47. Bruno Kestemont Lv 1 17 pts. 9,105
  8. Avatar for nicobul 48. nicobul Lv 1 16 pts. 9,104
  9. Avatar for johnmitch 49. johnmitch Lv 1 15 pts. 9,099
  10. Avatar for Timo van der Laan 50. Timo van der Laan Lv 1 15 pts. 9,097

Comments