Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for WBarme1234 71. WBarme1234 Lv 1 5 pts. 8,870
  2. Avatar for Jim Fraser 72. Jim Fraser Lv 1 5 pts. 8,866
  3. Avatar for alwen 73. alwen Lv 1 5 pts. 8,855
  4. Avatar for YeshuaLives 74. YeshuaLives Lv 1 4 pts. 8,851
  5. Avatar for Bautho 75. Bautho Lv 1 4 pts. 8,844
  6. Avatar for benrh 76. benrh Lv 1 4 pts. 8,843
  7. Avatar for ManVsYard 77. ManVsYard Lv 1 4 pts. 8,843
  8. Avatar for Bobnine 78. Bobnine Lv 1 3 pts. 8,841
  9. Avatar for dssb 79. dssb Lv 1 3 pts. 8,826
  10. Avatar for alcor29 80. alcor29 Lv 1 3 pts. 8,819

Comments