Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for Deleted player 81. Deleted player pts. 8,808
  2. Avatar for fishercat 82. fishercat Lv 1 3 pts. 8,801
  3. Avatar for Fractalsfixcancer 83. Fractalsfixcancer Lv 1 3 pts. 8,795
  4. Avatar for Merf 84. Merf Lv 1 2 pts. 8,765
  5. Avatar for Flagg65a 85. Flagg65a Lv 1 2 pts. 8,758
  6. Avatar for pmdpmd 86. pmdpmd Lv 1 2 pts. 8,738
  7. Avatar for froggs554 87. froggs554 Lv 1 2 pts. 8,737
  8. Avatar for Mr_Jolty 88. Mr_Jolty Lv 1 2 pts. 8,728
  9. Avatar for mitarcher 89. mitarcher Lv 1 2 pts. 8,728
  10. Avatar for Superphosphate 90. Superphosphate Lv 1 2 pts. 8,722

Comments