Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,518
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,511
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,496
  4. Avatar for Go Science 4. Go Science 33 pts. 9,485
  5. Avatar for Contenders 5. Contenders 22 pts. 9,330
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,190
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,157
  9. Avatar for freefolder 9. freefolder 3 pts. 9,151
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,986
  1. Avatar for Skippysk8s 11. Skippysk8s Lv 1 13 pts. 9,493
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 10 pts. 9,485
  3. Avatar for jamiexq 13. jamiexq Lv 1 7 pts. 9,485
  4. Avatar for alwen 14. alwen Lv 1 6 pts. 9,483
  5. Avatar for toshiue 15. toshiue Lv 1 4 pts. 9,480
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 3 pts. 9,476
  7. Avatar for alcor29 17. alcor29 Lv 1 2 pts. 9,473
  8. Avatar for Deleted player 18. Deleted player pts. 9,460
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 1 pt. 9,454
  10. Avatar for Hollinas 20. Hollinas Lv 1 1 pt. 9,444

Comments