Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,518
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,511
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,496
  4. Avatar for Go Science 4. Go Science 33 pts. 9,485
  5. Avatar for Contenders 5. Contenders 22 pts. 9,330
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,190
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,157
  9. Avatar for freefolder 9. freefolder 3 pts. 9,151
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,986

  1. Avatar for Deleted player 21. Deleted player pts. 9,441
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 1 pt. 9,330
  3. Avatar for georg137 23. georg137 Lv 1 1 pt. 9,328
  4. Avatar for mimi 24. mimi Lv 1 1 pt. 9,326
  5. Avatar for gitwut 25. gitwut Lv 1 1 pt. 9,315
  6. Avatar for Keresto 26. Keresto Lv 1 1 pt. 9,162
  7. Avatar for smholst 27. smholst Lv 1 1 pt. 9,133
  8. Avatar for crpainter 28. crpainter Lv 1 1 pt. 9,007
  9. Avatar for uihcv 29. uihcv Lv 1 1 pt. 8,958
  10. Avatar for ViJay7019 30. ViJay7019 Lv 1 1 pt. 8,947

Comments