Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028

  1. Avatar for benrh 91. benrh Lv 1 1 pt. 9,070
  2. Avatar for MadCat08 92. MadCat08 Lv 1 1 pt. 9,070
  3. Avatar for senor pit 93. senor pit Lv 1 1 pt. 9,062
  4. Avatar for Iron pet 94. Iron pet Lv 1 1 pt. 9,049
  5. Avatar for eromana 95. eromana Lv 1 1 pt. 9,047
  6. Avatar for fryguy 96. fryguy Lv 1 1 pt. 9,043
  7. Avatar for Mr_Jolty 98. Mr_Jolty Lv 1 1 pt. 9,028
  8. Avatar for rabamino12358 99. rabamino12358 Lv 1 1 pt. 9,023
  9. Avatar for skracked 100. skracked Lv 1 1 pt. 9,022

Comments