Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028

  1. Avatar for kamilko 101. kamilko Lv 1 1 pt. 9,021
  2. Avatar for SaraL 102. SaraL Lv 1 1 pt. 9,017
  3. Avatar for Mydogisa Toelicker 103. Mydogisa Toelicker Lv 1 1 pt. 9,000
  4. Avatar for Hollinas 104. Hollinas Lv 1 1 pt. 8,997
  5. Avatar for rinze 105. rinze Lv 1 1 pt. 8,983
  6. Avatar for Soggy Doglog 106. Soggy Doglog Lv 1 1 pt. 8,965
  7. Avatar for Flagg65a 107. Flagg65a Lv 1 1 pt. 8,965
  8. Avatar for Bobnine 108. Bobnine Lv 1 1 pt. 8,961
  9. Avatar for leehaggis 109. leehaggis Lv 1 1 pt. 8,959
  10. Avatar for uihcv 110. uihcv Lv 1 1 pt. 8,956

Comments