Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028

  1. Avatar for leannerikicheever 111. leannerikicheever Lv 1 1 pt. 8,953
  2. Avatar for trentis1 112. trentis1 Lv 1 1 pt. 8,949
  3. Avatar for harvardman 113. harvardman Lv 1 1 pt. 8,933
  4. Avatar for Arne Heessels 114. Arne Heessels Lv 1 1 pt. 8,924
  5. Avatar for SWR_DMaster 115. SWR_DMaster Lv 1 1 pt. 8,920
  6. Avatar for can1492 116. can1492 Lv 1 1 pt. 8,910
  7. Avatar for jebbiek 117. jebbiek Lv 1 1 pt. 8,905
  8. Avatar for fishercat 118. fishercat Lv 1 1 pt. 8,896
  9. Avatar for Ref_Jo 119. Ref_Jo Lv 1 1 pt. 8,891
  10. Avatar for roman madala 120. roman madala Lv 1 1 pt. 8,858

Comments