1385: Revisiting Puzzle 113: White Birch
Closed since almost 9 years ago
Intermediate Overall PredictionSummary
- Created
- May 31, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
