Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,764
  1. Avatar for stomjoh 21. stomjoh Lv 1 49 pts. 9,460
  2. Avatar for pauldunn 22. pauldunn Lv 1 47 pts. 9,460
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 45 pts. 9,459
  4. Avatar for phi16 24. phi16 Lv 1 43 pts. 9,451
  5. Avatar for johnmitch 25. johnmitch Lv 1 42 pts. 9,450
  6. Avatar for nicobul 26. nicobul Lv 1 40 pts. 9,441
  7. Avatar for frood66 27. frood66 Lv 1 38 pts. 9,439
  8. Avatar for crpainter 28. crpainter Lv 1 37 pts. 9,438
  9. Avatar for reefyrob 29. reefyrob Lv 1 35 pts. 9,435
  10. Avatar for tony46 30. tony46 Lv 1 34 pts. 9,429

Comments