Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028

  1. Avatar for katling 31. katling Lv 1 32 pts. 9,427
  2. Avatar for jobo0502 32. jobo0502 Lv 1 31 pts. 9,425
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 30 pts. 9,403
  4. Avatar for kabubi 34. kabubi Lv 1 29 pts. 9,400
  5. Avatar for anthion 35. anthion Lv 1 27 pts. 9,393
  6. Avatar for alcor29 36. alcor29 Lv 1 26 pts. 9,390
  7. Avatar for guineapig 37. guineapig Lv 1 25 pts. 9,386
  8. Avatar for NinjaGreg 38. NinjaGreg Lv 1 24 pts. 9,377
  9. Avatar for pvc78 39. pvc78 Lv 1 23 pts. 9,370
  10. Avatar for tarimo 40. tarimo Lv 1 22 pts. 9,368

Comments